PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03885.1.g00030.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 219aa    MW: 22972.1 Da    PI: 7.6147
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03885.1.g00030.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.32.3e-31123181159
                                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                     ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg+Hnh 
  Zpz_sc03885.1.g00030.1.am.mkhc 123 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDRDDPTYVVTTYEGTHNHV 181
                                     59********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-33110183IPR003657WRKY domain
SuperFamilySSF1182904.32E-28115183IPR003657WRKY domain
PROSITE profilePS5081131.766118183IPR003657WRKY domain
SMARTSM007743.0E-35123182IPR003657WRKY domain
PfamPF031061.0E-24124180IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAAVGARPVL YHSAAGDEAS SMSSYFSRGG SSTSSSASSF SAALAPAPPP DPAAQFDISE  60
FFDDVAQGVF GGPLHAVDAT STAHVVPADS GAAAAGAGGQ SAANARSAAE RIAFRMRSEI  120
EVLDDGYKWR KYGKKSVKNS PNPRNYYRCS TEGCNVKKRV ERDRDDPTYV VTTYEGTHNH  180
VSPSTVYYAS QDAASGRFFV AGTQPPPAGR PFPSSASSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-261181841278Probable WRKY transcription factor 4
2lex_A9e-261181841278Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8378811e-129CT837881.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA124O14, full insert sequence.
GenBankDQ2981791e-129DQ298179.1 Oryza sativa WRKY transcription factor 7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440147.13e-82hypothetical protein SORBIDRAFT_09g026830
SwissprotQ8VWQ53e-42WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLC5YUJ23e-82C5YUJ2_SORBI; Putative uncharacterized protein Sb09g026830
STRINGSb09g026830.11e-81(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-40WRKY DNA-binding protein 50